PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009774669.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 144aa    MW: 16621.7 Da    PI: 5.2727
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009774669.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.6e-132181363
                    XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                    ++++ +r+++NRe+ArrsR RK++ +eeL   + +L+++N   +++++    ++ +l++e+
  XP_009774669.1 21 DDRKRKRMESNRESARRSRMRKQQHLEELMSQMTQLQNQNVLWREKIDAVGRNYLTLDAEN 81
                    68999*******************************************9999999988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-181983IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-111970No hitNo description
PROSITE profilePS5021710.7492184IPR004827Basic-leucine zipper domain
PfamPF001706.9E-102276IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.94E-122377No hitNo description
CDDcd147026.37E-182474No hitNo description
PROSITE patternPS0003602641IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MALTQQPASS GSDGQRYATN DDRKRKRMES NRESARRSRM RKQQHLEELM SQMTQLQNQN  60
VLWREKIDAV GRNYLTLDAE NNVLRAQMAE LTERLDSLNS LTRFWADANG LAVDIPEIPD  120
TLLEPWQLPC PIQPITASAD MFQF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13542RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0324780.0AB032478.1 Nicotiana tabacum tbzF mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774669.11e-103PREDICTED: ocs element-binding factor 1-like
RefseqXP_016485106.11e-103PREDICTED: bZIP transcription factor 53-like
SwissprotQ9LZP87e-49BZP53_ARATH; bZIP transcription factor 53
TrEMBLQ9FXU11e-103Q9FXU1_TOBAC; TBZF
STRINGSolyc01g079480.2.11e-95(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28102351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.14e-50basic region/leucine zipper motif 53